PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000193216
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 398aa    MW: 43787.2 Da    PI: 7.9034
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000193216genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.74.3e-32243300259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers++dp++v++tYeg+H h+
  MDP0000193216 243 EDGYRWRKYGQKAVKNSPFPRSYYRCTNTKCTVKKRVERSSQDPTTVITTYEGQHCHH 300
                    8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-33227301IPR003657WRKY domain
SuperFamilySSF1182901.57E-27234300IPR003657WRKY domain
PROSITE profilePS5081129.666237302IPR003657WRKY domain
SMARTSM007741.8E-37242301IPR003657WRKY domain
PfamPF031068.1E-25243300IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MDDNNQKRDP LTTTEFTTHT WTPDSDSAYF FNTHDRDNXI LSDFGWIFNP EASKPDDGFP  60
CLDPIAAAAD TSDLAGTTSS GPLVLDNNSS SSSAAFGSPD PAPVVGSAST NPSVSTSSSE  120
DPPERSTGSG GKPPSEIPEC KICNWGVRPY AVESKKLEEA PLHASWGGIF VNPQRFRAWQ  180
SKFNRDGRAF QVSNFMDANT AVTAAGWRAK IHTFRSKVKM KGPKRIRQPR FAFMTKSEVD  240
NLEDGYRWRK YGQKAVKNSP FPRSYYRCTN TKCTVKKRVE RSSQDPTTVI TTYEGQHCHH  300
TVAFPRGGVM GHESGFTGHQ LSQLPPASQF MYYPTIRPRE ITSPINLTPT SSHQVVVPRH  360
DDDQAAGGSS HSTDRQPTPP LPTDEGLLGD VVPPGMRN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-25232299774Probable WRKY transcription factor 4
2lex_A5e-25232299774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389416.11e-132PREDICTED: probable WRKY transcription factor 57 isoform X1
RefseqXP_008389417.11e-132PREDICTED: probable WRKY transcription factor 57 isoform X1
TrEMBLM5XCG61e-95M5XCG6_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108143140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-57WRKY DNA-binding protein 57